PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00294.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 264aa    MW: 30390.2 Da    PI: 6.0572
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00294.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  +++++G g+W++ ++  g+ R++k+c++rw +yl
       KHN00294.1 14 KGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding537.9e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+e++++ +++lG++ W++Ia++++ gRt++++k+ w+++l
       KHN00294.1  67 RGNFSSEEEEIIIKMHELLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.164961IPR017930Myb domain
SuperFamilySSF466891.11E-3110108IPR009057Homeodomain-like
SMARTSM007173.3E-141363IPR001005SANT/Myb domain
PfamPF002494.7E-171461IPR001005SANT/Myb domain
CDDcd001671.01E-101661No hitNo description
PROSITE profilePS5129425.33662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2665116IPR009057Homeodomain-like
SMARTSM007176.4E-1566114IPR001005SANT/Myb domain
PfamPF002496.9E-1567112IPR001005SANT/Myb domain
CDDcd001672.28E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILMSYIQ KHGHGNWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SSEEEEIIIK MHELLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLMNSD  120
TNKRVSKPRI KRSDSNSSTL TQSEPTSSSG CTTSSDFSSF SEGTKNMDNM IKREDIESME  180
TVMPPIDESF WPQETVDYES STMMQSSNSW TISNELAPPQ YQFNSVETFQ QQSVGYNDSK  240
FDDGMDFWYD IFIKSGESIE LPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0291600.0AB029160.1 Glycine max GmMYB29A1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535693.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A0B2NYG50.0A0A0B2NYG5_GLYSO; Myb-related protein Myb4
STRINGGLYMA10G00930.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-81myb domain protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]